HORDB

ID: hor006902
Uniprot ID: P06302??2-112)
Protein name: Prothymosin alpha
Gene name: GH1
Organism: Rattus norvegicus
Family: Pro/parathymosin family
Source: Human
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
GO MF: GO:0005634 nucleus
GO BP: GO:0140713 histone chaperone activity; GO:0140297 DNA-binding transcription factor binding; GO:0042393 histone binding
GO CC: GO:0030154 cell differentiation; GO:0051092 positive regulation of NF-kappaB transcription factor activity; GO:0006325 chromatin organization; GO:0043066 negative regulation of apoptotic process; GO:0045944 positive regulation of transcription by RNA polymerase II

Sequence: SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD
Length: 111
Propeptide: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: